Biotin-conjugated DNAJB9 Polyclonal antibody

• 

  IHC staining of human breast cancer using Biotin-13157

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using Biotin-13157(DNAJB9 antibody) at dilution of 1:600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using Biotin-13157

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using Biotin-13157(DNAJB9 antibody) at dilution of 1:600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using Biotin-13157

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using Biotin-13157(DNAJB9 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using Biotin-13157

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using Biotin-13157(DNAJB9 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

DNAJB9 Polyclonal Antibody for IHC

Cat No. Biotin-13157

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

Synonyms

DNAJB 9, Endoplasmic reticulum DNA J domain-containing protein 4, ERdj4, ER-resident protein ERdj4, Mdg 1

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-13157 targets DNAJB9 in IHC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3789

  Product name: Recombinant human DNAJB9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-223 aa of BC028912

  Sequence: SYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ

• Full Name: DnaJ (Hsp40) homolog, subfamily B, member 9
• Calculated Molecular Weight: 223 aa, 26 kDa
• GenBank Accession Number: BC028912
• Gene Symbol: DNAJB9
• Gene ID (NCBI): 4189
• RRID: AB_2883056
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBS3
• Storage Buffer: PBS with 50% Glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.