C10orf58 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C10orf58 Polyclonal antibody, PBS Only (20446-1-PBS)

• 

  WB analysis of ROS1728 using 20446-1-AP (same clone as 20446-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 20446-1-AP (C10orf58 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20446-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 20446-1-AP (same clone as 20446-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 20446-1-AP (C10orf58 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 20446-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 20446-1-AP (same clone as 20446-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 20446-1-AP (C10orf58 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 20446-1-PBS in a different storage buffer formulation.

• 

  IF Staining of ROS1728 using 20446-1-AP (same clone as 20446-1-PBS)

  Immunofluorescent analysis of ROS1728 cells using 20446-1-AP (C10orf58 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20446-1-PBS in a different storage buffer formulation.

• 

  IF Staining of ROS1728 using 20446-1-AP (same clone as 20446-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed ROS1728 cells using C10orf58 antibody (20446-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20446-1-PBS in a different storage buffer formulation.

C10orf58 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20446-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

F213A, FAM213A, PAMM, Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes, Peroxiredoxin-like 2A

---

Product Information

20446-1-PBS targets C10orf58 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14272

  Product name: Recombinant human C10orf58 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-229 aa of BC005871

  Sequence: DVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK

• Full Name: chromosome 10 open reading frame 58
• Calculated Molecular Weight: 229 aa, 26 kDa
• Observed Molecular Weight: 24-30 kDa
• GenBank Accession Number: BC005871
• Gene Symbol: C10orf58
• Gene ID (NCBI): 84293
• RRID: AB_2878687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C10orf58, also name as FAM213A and PAMM, is involved in redox regulation of the cell. It acts as an antioxidant. C10orf58 inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation. It may affect bone resorption and help to maintain bone mass. The MW of C10orf58 is 24-30 kDa.