C12orf29 Recombinant monoclonal antibody, PBS Only (Capture)

C12orf29 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84708-1-PBS
Clone No.242163C3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

242163C3, RNA Ligase, RNA Ligase 1, Rnl

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84708-1-PBS targets C12orf29 as part of a matched antibody pair:

MP01512-1: 84708-1-PBS capture and 84708-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35681

Product name: Recombinant human C12orf29 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-150 aa of NM_001009894.2

Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNK

Predict reactive species
Full Name chromosome 12 open reading frame 29
Calculated Molecular Weight37kDa,325aa
Observed Molecular Weight37 kDa
GenBank Accession NumberNM_001009894.2
Gene Symbol C12orf29
Gene ID (NCBI) 91298
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N999
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

C12orf29, also known as RLIG1, is a 37 kDa human protein consisting of 325 amino acids. It catalyzes ATP-dependent RNA ligation via a three-step mechanism involving tandem auto- and RNA AMPylation (PMID: 36792600).

Loading...
||
New chat Able
正在加载,请稍候...