C12orf29 Recombinant monoclonal antibody

• 

  WB analysis of HeLa using 84708-1-RR

  WB result of C12orf29 antibody (84708-1-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C12orf29 transfected HeLa cells.

• 

  WB analysis of HeLa using 84708-1-RR

  HeLa cells were subjected to SDS PAGE followed by western blot with 84708-1-RR (C12orf29 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 84708-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84708-1-RR (C12orf29 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 84708-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84708-1-RR (C12orf29 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 84708-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84708-1-RR (C12orf29 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat pancreas using 84708-1-RR

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 84708-1-RR (C12orf29 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84708-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84708-1-RR against Human C12orf29 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

C12orf29 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84708-1-RR

Clone No.242163C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

242163C3, RNA Ligase, RNA Ligase 1, Rnl

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: mouse colon tissue, mouse pancreas tissue, rat pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84708-1-RR targets C12orf29 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35681

  Product name: Recombinant human C12orf29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_001009894.2

  Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNK

• Full Name: chromosome 12 open reading frame 29
• Calculated Molecular Weight: 37kDa，325aa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: NM_001009894.2
• Gene Symbol: C12orf29
• Gene ID (NCBI): 91298
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C12orf29, also known as RLIG1, is a 37 kDa human protein consisting of 325 amino acids. It catalyzes ATP-dependent RNA ligation via a three-step mechanism involving tandem auto- and RNA AMPylation (PMID: 36792600).