C19orf63 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C19orf63 Polyclonal antibody, PBS Only (30844-1-PBS)

• 

  WB analysis using 30844-1-AP (same clone as 30844-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30844-1-AP (C19orf63 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 30844-1-AP (same clone as 30844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30844-1-AP (C19orf63 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 30844-1-AP (same clone as 30844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 30844-1-AP (C19orf63 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30844-1-PBS in a different storage buffer formulation.

C19orf63 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30844-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

EMC10, ER Membrane Protein Complex Subunit 10, Hematopoietic signal peptide-containing membrane domain-containing protein 1, HSM1, HSS1

---

Product Information

30844-1-PBS targets C19orf63 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34064

  Product name: Recombinant human C19orf63 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC035001

  Sequence: MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYW

• Full Name: chromosome 19 open reading frame 63
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC035001
• Gene Symbol: C19orf63
• Gene ID (NCBI): 284361
• RRID: AB_3742375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5UCC4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EMC10 (Endoplasmic Reticulum Membrane Protein Complex Subunit 10) is one of the key components of the highly conserved endoplasmic reticulum membrane protein complex (EMC). The core function of this complex is to act as an insertase and chaperone in the endoplasmic reticulum, assisting in the correct folding, assembly, and membrane integration of membrane proteins, and preventing the aggregation of misfolded proteins. Studies have shown that EMC10 plays a dual role in cells: within the cell, it ensures the biogenesis of important membrane proteins such as G protein-coupled receptors (GPCRs); moreover, it can be secreted outside the cell (referred to as sEMC10), where it acts as a novel signaling molecule to activate the hypothalamic-pituitary axis, regulating energy metabolism and body weight in the body, and is closely related to obesity and metabolic diseases.