Use Able AI chat for product recommendations

C19orf63 Polyclonal antibody, PBS Only

C19orf63 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30844-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

EMC10, ER Membrane Protein Complex Subunit 10, Hematopoietic signal peptide-containing membrane domain-containing protein 1, HSM1, HSS1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30844-1-PBS targets C19orf63 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34064

Product name: Recombinant human C19orf63 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-227 aa of BC035001

Sequence: MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYW

Predict reactive species
Full Name chromosome 19 open reading frame 63
Observed Molecular Weight28 kDa
GenBank Accession NumberBC035001
Gene Symbol C19orf63
Gene ID (NCBI) 284361
RRIDAB_3742375
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ5UCC4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EMC10 (Endoplasmic Reticulum Membrane Protein Complex Subunit 10) is one of the key components of the highly conserved endoplasmic reticulum membrane protein complex (EMC). The core function of this complex is to act as an insertase and chaperone in the endoplasmic reticulum, assisting in the correct folding, assembly, and membrane integration of membrane proteins, and preventing the aggregation of misfolded proteins. Studies have shown that EMC10 plays a dual role in cells: within the cell, it ensures the biogenesis of important membrane proteins such as G protein-coupled receptors (GPCRs); moreover, it can be secreted outside the cell (referred to as sEMC10), where it acts as a novel signaling molecule to activate the hypothalamic-pituitary axis, regulating energy metabolism and body weight in the body, and is closely related to obesity and metabolic diseases.

Loading...
||
New chat

Able

正在加载,请稍候...