C1GALT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C1GALT1 Polyclonal antibody, PBS Only (27569-1-PBS)

• 

  WB analysis of T-47D using 27569-1-AP (same clone as 27569-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 27569-1-AP (C1GALT1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27569-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27569-1-AP (same clone as 27569-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27569-1-AP (C1GALT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27569-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 27569-1-AP (same clone as 27569-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27569-1-AP (C1GALT1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27569-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27569-1-AP (same clone as 27569-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C1GALT1 antibody (27569-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 27569-1-PBS in a different storage buffer formulation.

C1GALT1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 27569-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

B3Gal T8, Beta 1,3 galactosyltransferase, C1GALT, Core 1 beta3 Gal T1, Core 1 O glycan T synthase

---

Product Information

27569-1-PBS targets C1GALT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26144

  Product name: Recombinant human C1GALT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 263-363 aa of NM_020156

  Sequence: MKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP

• Full Name: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: NM_020156
• Gene Symbol: C1GALT1
• Gene ID (NCBI): 56913
• RRID: AB_2880912
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS00
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1), also known as B3Gal-T8, catalyzes the transfer of galactose (Gal) from UDP-Gal to N-acetylgalactosamine (GalNAc) O-linked esters of threonine and serine residues of target proteins, including IgA1, to form the T antigen (PMID: 28209808). C1GalT1 is overexpressed in many common cancers includingcolon, breast, gastric, lung, head and neck, pancreatic, esophageal, prostate, and hepatocellular cancer (PMID: 34944925). C1GALT1 protein contains 363 amino acids and is a typeII transmembrane protein. Rate C1GalT1 is an 84/86KDa disulfide-bonded homodimer, but its active form is believed to be a 42/43 KDa monomeric protein (PMID: 34149900).