• Featured Product
  • KD/KO Validated

C1QBP Monoclonal antibody

C1QBP Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 68084-1-Ig
Clone No.1F9B1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

gC1Q R, 1F9B1, ASF/SF2-associated protein p32, Complement component 1 Q subcomponent-binding protein, mitochondrial, GC1q R protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HEK-293 cells, mouse brain tissue, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman tonsillitis tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68084-1-Ig targets C1QBP in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19773

Product name: Recombinant human C1QBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-282 aa of BC013731

Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Predict reactive species
Full Name complement component 1, q subcomponent binding protein
Calculated Molecular Weight 282 aa, 31 kDa
Observed Molecular Weight32-35 kDa
GenBank Accession NumberBC013731
Gene Symbol C1QBP
Gene ID (NCBI) 708
RRIDAB_2918821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07021
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).

Protocols

Product Specific Protocols
FC protocol for C1QBP antibody 68084-1-IgDownload protocol
IF protocol for C1QBP antibody 68084-1-IgDownload protocol
IHC protocol for C1QBP antibody 68084-1-IgDownload protocol
WB protocol for C1QBP antibody 68084-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...