C1QBP Recombinant monoclonal antibody

• 

  WB analysis of HEK-293 using 80490-1-RR

  WB result of C1QBP antibody (80490-1-RR; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C1QBP transfected HEK-293 cells.

• 

  WB analysis using 80490-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80490-1-RR (C1QBP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 80490-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80490-1-RR (C1QBP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 80490-1-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80490-1-RR (C1QBP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 80490-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using C1QBP antibody (80490-1-RR, Clone: 3K20 ) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red).

• 

  FC experiment of HeLa using 80490-1-RR

  1X10^6 HeLa cells were intracellularly stained with 0.5 ug Anti-Human C1QBP (80490-1-RR, Clone:3K20) (red) labeled with FlexAble CoraLite® Plus 555 Antibody Labeling Kit for Rabbit IgG (KFA002), or 0.5 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 80490-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80490-1-RR against Human C1QBP were performed. The affinity constant is 0.776 nM.

• Featured Product
• KD/KO Validated

C1QBP Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 80490-1-RR

Clone No.3K20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

gC1Q R, 3K20, ASF/SF2-associated protein p32, Complement component 1 Q subcomponent-binding protein, mitochondrial, GC1q R protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80490-1-RR targets C1QBP in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19773

  Product name: Recombinant human C1QBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-282 aa of BC013731

  Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

• Full Name: complement component 1, q subcomponent binding protein
• Calculated Molecular Weight: 282 aa, 31 kDa
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: BC013731
• Gene Symbol: C1QBP
• Gene ID (NCBI): 708
• RRID: AB_2918896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07021
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).