HRP-conjugated C1qC Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• HRP-conjugated C1qC Recombinant monoclonal antibody (HRP-85031-5)

• 

  WB analysis of human plasma using HRP-85031-5

  human plasma were subjected to SDS PAGE followed by western blot with HRP-85031-5 (C1qC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

C1qC Uni-rAb^® Recombinant Antibody for WB

Cat No. HRP-85031-5

Clone No.242624B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB

Synonyms

Complement C1q C chain, C1Q C, 242624B1, C1QG

---

Tested Applications

• Positive WB detected in: human plasma

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

HRP-85031-5 targets C1qC in WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10400

  Product name: Recombinant human C1QC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-245 aa of BC009016

  Sequence: QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

• Full Name: complement component 1, q subcomponent, C chain
• Calculated Molecular Weight: 245 aa, 26 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC009016
• Gene Symbol: C1QC
• Gene ID (NCBI): 714
• RRID: AB_3749486
• Conjugate: HRP
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02747
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qC which is the C-chain polypeptide of human complement subcomponent C1q.