C20orf194 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C20orf194 Polyclonal antibody, PBS Only (23184-1-PBS)

• 

  WB analysis of mouse testis using 23184-1-AP (same clone as 23184-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 23184-1-AP (C20orf194 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23184-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 23184-1-AP (same clone as 23184-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 23184-1-AP (C20orf194 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 23184-1-AP (same clone as 23184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 23184-1-AP (same clone as 23184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 23184-1-AP (same clone as 23184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 23184-1-AP (same clone as 23184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23184-1-AP (C20orf194 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23184-1-PBS in a different storage buffer formulation.

C20orf194 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23184-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23184-1-PBS targets C20orf194 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19714

  Product name: Recombinant human C20orf194 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 568-916 aa of BC122529

  Sequence: GYTDVIDVVQALQTHPDSNVKASFTIGAITACVEPMSCYMEHRFLFPKCLDQCSQGLVSNVVFTSHTTEQRHPLLVQLQSLIRAANPAAAFILAENGIVTRNEDIELILSENSFSSPEMLRSRYLMYPGWYEGKLNAGSVYPLMVQICVWFGRPLEKTRFVAKCKAIQSSIKPSPFSGNIYHILGKVKFSDSERTMEVCYNTLANSLSIMPVLEGPTPPPDSKSVSQDSSGQQECYLVFIGCSLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP

• Full Name: chromosome 20 open reading frame 194
• Calculated Molecular Weight: 1177 aa, 132 kDa
• Observed Molecular Weight: 132 kDa
• GenBank Accession Number: BC122529
• Gene Symbol: C20orf194
• Gene ID (NCBI): 25943
• RRID: AB_2879227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5TEA3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.