C20orf20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C20orf20 Polyclonal antibody, PBS Only (26040-1-PBS)

• 

  WB analysis of HepG2 using 26040-1-AP (same clone as 26040-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26040-1-AP (C20orf20 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26040-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 26040-1-AP (same clone as 26040-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26040-1-AP (C20orf20 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26040-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 26040-1-AP (same clone as 26040-1-PBS)

  IP result of anti-C20orf20 (IP:26040-1-AP, 4ug; Detection:26040-1-AP 1:300) with HepG2 cells lysate 2640ug. This data was developed using the same antibody clone with 26040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 26040-1-AP (same clone as 26040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26040-1-AP (C20orf20 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26040-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 26040-1-AP (same clone as 26040-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26040-1-AP (C20orf20 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26040-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 26040-1-AP (same clone as 26040-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using C20orf20 antibody (26040-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 26040-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C20orf20 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 26040-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Eaf7, MRG/MORF4L-binding protein, MRG15BP, MRG-binding protein, MRGBP

---

Product Information

26040-1-PBS targets C20orf20 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22840

  Product name: Recombinant human C20orf20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC014235

  Sequence: MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT

• Full Name: chromosome 20 open reading frame 20
• Calculated Molecular Weight: 204 aa, 22 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC014235
• Gene Symbol: C20orf20
• Gene ID (NCBI): 55257
• RRID: AB_2880347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NV56
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C20orf20, also named as MRG/MORF4L-binding protein or Up-regulated in colon cancer 4 (Urcc4), is a 204 amino acid protein, which belongs to the EAF7 family. C20orf20 localizes in the nucleus and is a Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. C20orf20 is modified through phosphorylation and acetylation, so the molecular weight of C20orf20 might be 25-30 kDa.