C20orf3/APMAP Monoclonal antibody

• Home
• Products
• Primary Antibodies
• C20orf3/APMAP Monoclonal antibody (67464-1-Ig)

• Featured Product
• KD/KO Validated

C20orf3/APMAP Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67464-1-Ig Copied!

Clone No. 1C6C2

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, IF, ELISA

Synonyms

C20orf3, 1C6C2, Adipocyte plasma membrane-associated protein, APMAP, BSCv

• 

  WB analysis using 67464-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67464-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 67464-1-Ig

  WB result of C20orf3/APMAP antibody (67464-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C20orf3/APMAP transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67464-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67464-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 67464-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 67464-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67464-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67464-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C20orf3/APMAP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HSC-T6 cells, rabbit liver tissue, HepG2 cells, LNCaP cells, NIH/3T3 cells, human placenta tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67464-1-Ig targets C20orf3/APMAP in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Cited Reactivity: rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29996

  Product name: Recombinant human C20orf3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 66-416 aa of BC003501

  Sequence: DPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

• Full Name: chromosome 20 open reading frame 3
• Calculated Molecular Weight: 416 aa, 46 kDa
• Observed Molecular Weight: 42-46 kDa
• GenBank Accession Number: BC003501
• Gene Symbol: APMAP
• Gene ID (NCBI): 57136
• RRID: AB_2882693
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9HDC9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The C20orf3/APMAP Monoclonal antibody (1C6C2), catalog number 67464-1-Ig, has 2 total citations. These appear in Food Chemistry (Oxford) and Journal of Neurochemistry. The associated research fields span food science and proteomics (meat quality analysis in rabbits) and neuroscience (DNA methylation and gene expression in sepsis-associated encephalopathy affecting spatial memory).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rabbit	WB	Food Chem (Oxf); Transcriptomics and 4D-DIA proteomic analysis reveal differences in meat quality between Sichuan white rabbits and New Zealand white rabbits.; Authors - Liangde Kuang
	IF	J Neurochem; Integrative Analysis of DNA Methylation and Gene Expression Reveals Key Molecular Signatures in Spatial Memory Impairment of Sepsis-Associated Encephalopathy; Authors - Xin Liu