C20orf3/APMAP Monoclonal antibody, PBS Only

• 

  WB analysis using 67464-1-Ig (same clone as 67464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67464-1-Ig (same clone as 67464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67464-1-Ig (same clone as 67464-1-PBS)

  WB result of C20orf3/APMAP antibody (67464-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C20orf3/APMAP transfected HepG2 cells. This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67464-1-Ig (same clone as 67464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67464-1-Ig (same clone as 67464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67464-1-Ig (same clone as 67464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67464-1-Ig (same clone as 67464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67464-1-Ig (same clone as 67464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67464-1-Ig (same clone as 67464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67464-1-Ig (C20orf3/APMAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67464-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C20orf3/APMAP Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67464-1-PBS

Clone No.1C6C2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

C20orf3, 1C6C2, Adipocyte plasma membrane-associated protein, APMAP, BSCv

---

Product Information

67464-1-PBS targets C20orf3/APMAP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29996

  Product name: Recombinant human C20orf3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 66-416 aa of BC003501

  Sequence: DPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV

• Full Name: chromosome 20 open reading frame 3
• Calculated Molecular Weight: 416 aa, 46 kDa
• Observed Molecular Weight: 42-46 kDa
• GenBank Accession Number: BC003501
• Gene Symbol: APMAP
• Gene ID (NCBI): 57136
• RRID: AB_2882693
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9HDC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.