C3orf22 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C3orf22 Polyclonal antibody, PBS Only (32918-1-PBS)

• 

  WB analysis using 32918-1-AP (same clone as 32918-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32918-1-AP (C3orf22 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32918-1-PBS in a different storage buffer formulation.

C3orf22 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32918-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Uncharacterized protein C3orf22

---

Product Information

32918-1-PBS targets C3orf22 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38384

  Product name: Recombinant human C3orf22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC032025

  Sequence: MDSSACKKSHQSKKWRIQAQENFAKKFPYRLSWLTEPDPEPLQPWEVTNDSNTVQLPLQKRLVPTRSIPVRGLGAPDFTSPSGSCPAPLPAPSPPPLCNLWELKLLSRRFPRQLAFLLSTRHTEAACPQTSKAAGLSRGLS

• Full Name: chromosome 3 open reading frame 22
• Calculated Molecular Weight: 141 aa, 16 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC032025
• Gene Symbol: C3orf22
• Gene ID (NCBI): 152065
• RRID: AB_3742787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5N4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C3orf22 is a gene located on chromosome 3 that encodes a protein known as Chromosome 3 Open Reading Frame 22. During embryonic development, C3orf22 is expressed in various tissues and organs, such as the brain, heart, and limbs. Its expression may be regulated by developmental stage-specific factors and signaling pathways.