C9orf61 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C9orf61 Polyclonal antibody, PBS Only (25630-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 25630-1-AP (same clone as 25630-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25630-1-AP (C9orf61 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 25630-1-AP (same clone as 25630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 25630-1-AP (C9orf61 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 25630-1-AP (same clone as 25630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 25630-1-AP (C9orf61 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 25630-1-AP (same clone as 25630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25630-1-AP (C9orf61 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 25630-1-AP (same clone as 25630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25630-1-AP (C9orf61 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25630-1-PBS in a different storage buffer formulation.

C9orf61 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25630-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Endosomal transmembrane binding with epsin, Endosomal transmembrane epsin interactor 1, ENTREP1, FAM189A2, Protein FAM189A2

---

Product Information

25630-1-PBS targets C9orf61 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22242

  Product name: Recombinant human C9orf61 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 288-450 aa of BC113685

  Sequence: PVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMTPDIHELVENIKSVLKSDEEHMEEAITSASFLEQIMAPLQPSTSRAHKLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL

• Full Name: chromosome 9 open reading frame 61
• Calculated Molecular Weight: 450 aa, 50 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC113685
• Gene Symbol: C9orf61
• Gene ID (NCBI): 9413
• RRID: AB_2880170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15884
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C9orf61, also named as FAM189A2 and X123, is promoinently expressed in muscle. It has three isoforms with MW 45-50 kDa, 32-35 kDa and 27 kDa.