C9orf72 Monoclonal antibody

C9orf72 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67824-1-Ig
Clone No.2F9A2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), ELISA

2F9A2, C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, HEK-293 cells, U-87 MG cells, Neuro-2a cells, PC-12 cells, C6 cells, rat brain tissue, mouse brain tissue
Positive IHC detected inmouse lung tissue, mouse intestine, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67824-1-Ig targets C9orf72 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21080

Product name: Recombinant human C9orf72 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-169 aa of BC020851

Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG

Predict reactive species
Full Name chromosome 9 open reading frame 72
Calculated Molecular Weight 481 aa, 54 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC020851
Gene Symbol C9orf72
Gene ID (NCBI) 203228
RRIDAB_2918586
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96LT7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa.

Protocols

Product Specific Protocols
FC protocol for C9orf72 antibody 67824-1-IgDownload protocol
IHC protocol for C9orf72 antibody 67824-1-IgDownload protocol
WB protocol for C9orf72 antibody 67824-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...