Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Calbindin-D28k Polyclonal antibody

Calbindin-D28k Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA

CALB1, Calbindin, CALB, calbindin 1, 28kDa, Calbindin D28

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Calbindin-D28k in ?

Tested Applications

Positive WB detected infetal human brain tissue, mouse brain tissue, rat brain tissue, mouse cerebellum tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman cerebellum tissue, hippocampus, human brain tissue, human kidney tissue, mouse cerebellum tissue, mouse kidney tissue, rat cerebellum tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse cerebellum tissue, human kidney tissue
Positive IF-Fro detected inmouse cerebellum tissue, rat cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14479-1-AP targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5861

Product name: Recombinant human Calbindin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-261 aa of BC006478

Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

Predict reactive species
Full Name calbindin 1, 28kDa
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC006478
Gene Symbol Calbindin
Gene ID (NCBI) 793
RRIDAB_2228318
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05937
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.

Protocols

Product Specific Protocols
IF protocol for Calbindin-D28k antibody 14479-1-APDownload protocol
IHC protocol for Calbindin-D28k antibody 14479-1-APDownload protocol
IP protocol for Calbindin-D28k antibody 14479-1-APDownload protocol
WB protocol for Calbindin-D28k antibody 14479-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Calbindin-D28k polyclonal antibody (Cat# 14479-1-AP) has 63 citations spanning high-impact journals including Nature, Cell, Immunity, Nature Neuroscience, Nature Communications, JCI, and Cell Death & Differentiation, among others. Research fields covered include neuroscience (cerebellar function, epilepsy, neurodegeneration, Parkinson's disease), renal disease, retinal biology, autophagy, ferroptosis, developmental biology, and cancer.

SpeciesApplicationTitle
mouseIF

Nature

Reversing a model of Parkinson's disease with in situ converted nigral neurons.

Authors - Hao Qian
mouseIF

Cell

Glia-to-Neuron Conversion by CRISPR-CasRx Alleviates Symptoms of Neurological Disease in Mice.

Authors - Haibo Zhou
mouseIHC

Immunity

Circulating senescent myeloid cells infiltrate the brain and cause neurodegeneration in histiocytic disorders

Authors - C Matthias Wilk
mouseIF

Nat Neurosci

Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage

Authors - Yao Wei
mouseIF

Autophagy

Heat-shock chaperone HSPB1 mitigates poly-glycine-induced neurodegeneration via restoration of autophagic flux

Authors - Ning Ding
ratIF

Autophagy

Autophagy and post-ischemic conditioning in retinal ischemia.

Authors - Biji Mathew

Reviews

    5.0 out of 5
Add a review

4 verified customer reviews

What customers say

All four reviews are 5-star ratings. Users report excellent performance in immunohistochemistry on mouse brain (1:1000), with clear labeling of cell bodies and dendrites. One user successfully applied it to brain vibratome sections by immunofluorescence (1:300) after acid-alcohol pretreatment. Two additional reviews confirm reliable results when tested on an antibody microarray using EDTA plasma. Overall, reviewers highlight strong specificity and consistent performance across tissue types and applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Georgiana (Verified Customer) (09-11-2023)

Antibody labelled cell bodies and dendrites very clearly

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse brain
Calbindin-D28k Antibody Immunohistochemistry validation (1:1000 dilution) in mouse brain (Cat no:14479-1-AP)

Ramzi (Verified Customer) (06-14-2023)

The brain vibratome sections were treated with Acid-Alcohol before the blocking solution.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: brain tissue ''Vibratome ''
Calbindin-D28k Antibody Immunofluorescence validation (1:300 dilution) in brain tissue ''Vibratome '' (Cat no:14479-1-AP)

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other
Loading...
||
New chat

Able™

正在加载,请稍候...