• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Calbindin-D28k Polyclonal antibody

Calbindin-D28k Polyclonal Antibody for IF-P
Cat No. CL488-14479

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

CALB1, Calbindin, CALB, calbindin 1, 28kDa, Calbindin D28

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman kidney tissue, mouse cerebellum tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14479 targets Calbindin-D28k in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5861

Product name: Recombinant human Calbindin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 109-261 aa of BC006478

Sequence: KYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

Predict reactive species
Full Name calbindin 1, 28kDa
Calculated Molecular Weight 30 kDa
GenBank Accession NumberBC006478
Gene Symbol Calbindin
Gene ID (NCBI) 793
RRIDAB_2919092
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05937
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Calbindin-D28k antibody CL488-14479Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...