Tested Applications
| Positive WB detected in | A2780 cells, HeLa cells, HT-1080 cells, MDA-MB-231 cells, PC-3 cells, SKOV-3 cells |
| Positive IHC detected in | human colon tissue, mouse heart tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20887-1-AP targets Caldesmon in WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV Predict reactive species |
| Full Name | caldesmon 1 |
| Calculated Molecular Weight | 538 aa, 63 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC040354 |
| Gene Symbol | CALD1 |
| Gene ID (NCBI) | 800 |
| RRID | AB_10792408 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05682 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Caldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Caldesmon antibody 20887-1-AP | Download protocol |
| IF protocol for Caldesmon antibody 20887-1-AP | Download protocol |
| IHC protocol for Caldesmon antibody 20887-1-AP | Download protocol |
| WB protocol for Caldesmon antibody 20887-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Caldesmon (CALD1) Polyclonal antibody (Cat# 20887-1-AP) has 12 citations. These appear in journals including Cell Reports, Frontiers in Immunology, JCI Insight, JAHA, International Journal of Molecular Sciences, Scientific Reports, Cancers, Cell Signaling, iScience, Frontiers in Physiology, Frontiers in Medicine, and bioRxiv. Research fields span vascular biology, aging, cytoskeletal regulation, cancer (hepatocellular, colorectal, gastric), Crohn's disease fibrosis, and osteogenic differentiation, with applications mainly in WB, IF, IHC, and CoIP.
| Species | Application | Title |
|---|---|---|
Cell Rep Proline restores mitochondrial function and reverses aging hallmarks in senescent cells | ||
Front Immunol IL-2Rα KO mice exhibit maternal microchimerism and reveal nuclear localization of IL-2Rα in lymphoid and non-lymphoid cells. | ||
JCI Insight Vascular smooth muscle RbFox2 regulates the cytoskeleton and arterial stiffness by a RhoBTB1-Cullin-3 mechanism. | ||
J Am Heart Assoc Magnesium Sulfate-Mediated Vascular Relaxation and Calcium Channel Activity in Placental Vessels Different From Nonplacental Vessels. | ||
Int J Mol Sci Multi-Omics and Machine Learning-Based Characterization of the Lactylation Microenvironment and Biomarker Identification in Crohn's Disease Intestinal Fibrosis. | ||
Sci Rep Nicotine facilitates VSMC dysfunction through a miR-200b/RhoGDIA/cytoskeleton module. |
Reviews
What customers say
The single review for this antibody is highly positive, rated 5 stars. The reviewer used it at a 1:5000 dilution for Western Blot, Immunoprecipitation, and cell culture applications across multiple cell lines and tissues including HEK293, A7R5, HTR8, liver, placenta, and aorta. They described it as an excellent antibody with results better than expected, noting it works well in both Co-IP and Western blotting.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gaurav (Verified Customer) (01-22-2024) | Excellent antibody. Results are better than expected. Works well in Co-IP as well as in western blotting
 |
