Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Caldesmon Monoclonal antibody, PBS Only (Capture)

Caldesmon Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66693-1-PBS
Clone No.1E1C11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

CALD1, 1E1C11, CAD, caldesmon 1, CDM

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66693-1-PBS targets Caldesmon as part of a matched antibody pair:

MP51351-1: 66693-1-PBS capture and 66693-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13676

Product name: Recombinant human CALD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 196-538 aa of BC040354

Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV

Predict reactive species
Full Name caldesmon 1
Calculated Molecular Weight 538 aa, 63 kDa
Observed Molecular Weight 70 kDa~75 kDa
GenBank Accession NumberBC040354
Gene Symbol CALD1
Gene ID (NCBI) 800
RRIDAB_2882047
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ05682
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Caldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308).

Loading...
||
New chat

Able

正在加载,请稍候...