CALD1 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66693-1-Ig (same clone as 66693-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66693-1-Ig (CALD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66693-1-Ig (same clone as 66693-1-PBS)

  WB result of CALD1 antibody (66693-1-Ig; 1:50000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CALD1 transfected HeLa cells. This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66693-1-Ig (same clone as 66693-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66693-1-Ig (CALD1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hysteromyoma using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hysteromyoma tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hysteromyoma using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hysteromyoma tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66693-1-Ig (CALD1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CALD1 antibody (66693-1-Ig, Clone: 1E1C11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66693-1-Ig (same clone as 66693-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using CALD1 antibody (66693-1-Ig, Clone: 1E1C11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 66693-1-Ig (same clone as 66693-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human CALD1 (66693-1-Ig, Clone:1E1C11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66693-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51351-1

  Sample test of MP51351-1, CALD1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66693-1-PBS. Detection antibody: 66693-2-PBS.

• 

  Cytometric bead array standard curve of MP51351-1

  Cytometric bead array standard curve of MP51351-1, CALD1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66693-1-PBS. Detection antibody: 66693-2-PBS. Standard:Ag13676. Range: 0.391-400 ng/mL.

• Featured Product
• KD/KO Validated

CALD1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66693-1-PBS

Clone No.1E1C11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

Caldesmon, 1E1C11, CAD, caldesmon 1, CDM

---

Product Information

66693-1-PBS targets CALD1 as part of a matched antibody pair:

MP51351-1: 66693-1-PBS capture and 66693-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13676

  Product name: Recombinant human CALD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 196-538 aa of BC040354

  Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV

• Full Name: caldesmon 1
• Calculated Molecular Weight: 538 aa, 63 kDa
• Observed Molecular Weight: 70 kDa~75 kDa
• GenBank Accession Number: BC040354
• Gene Symbol: CALD1
• Gene ID (NCBI): 800
• RRID: AB_2882047
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q05682
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.