Tested Applications
| Positive WB detected in | NCI-H1299 cells, HeLa cells, U2OS cells, HepG2 cells, PC-3 cells, SKOV-3 cells, A2780 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, Calu-1 cells, Caco-2 cells, Caki-1 cells, MCF-10A cells, LNCaP cells, SK-N-SH cells |
| Positive IHC-Autostainer detected in | human colon tissue |
| Positive IHC detected in | human colon cancer tissue, human colon tissue, human hysteromyoma tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66693-1-Ig targets Caldesmon in WB, IHC, IHC-Autostainer, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, monkey |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV Predict reactive species |
| Full Name | caldesmon 1 |
| Calculated Molecular Weight | 538 aa, 63 kDa |
| Observed Molecular Weight | 70 kDa~75 kDa |
| GenBank Accession Number | BC040354 |
| Gene Symbol | CALD1 |
| Gene ID (NCBI) | 800 |
| RRID | AB_2882047 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q05682 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Caldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| IF protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| IHC protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| WB protocol for Caldesmon antibody 66693-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Caldesmon Monoclonal antibody (1E1C11), catalog number 66693-1-Ig, has 8 total citations. These appear in journals including Scientific Reports, International Journal of Molecular Sciences, Placenta, International Journal of Clinical Practice, bioRxiv, and Auris Nasus Larynx. Research fields span osteogenic differentiation, cochlear/auditory biology, preeclampsia, gastric cancer, hair loss cell therapy, and cytoskeletal proteomics.
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Changes in the Expression of Smooth Muscle Cell-Related Genes in Human Dermal Sheath Cup Cells Associated with the Treatment Outcome of Autologous Cell-Based Therapy for Male and Female Pattern Hair Loss. | ||
Sci Rep Cell-specific α and β subunit expression patterns of Na+/K+-ATPases in the common marmoset cochlea | ||
Sci Rep Distinct Connexin43, Connexin31, and Pannexin1 expression patterns in the cochlea of a non-human primate. | ||
Sci Rep Caldesmon-1-mediated actin dynamics is essential for osteogenic differentiation of aortic valve interstitial cells.
| ||
Placenta Endothelin-1 potentiated constriction in preeclampsia placental veins: Role of ETAR/ETBR/CaV1.2/CALD1 | ||
Int J Clin Pract GPX3-Mediated Oxidative Stress Affects Pyrimidine Metabolism Levels in Stomach Adenocarcinoma via the AMPK/mTOR Pathway |
