CoraLite® Plus 488-conjugated CARD11 Monoclonal antibody

CARD11 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68269
Clone No.3F5H6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

3F5H6, CARD-containing MAGUK protein 1, Carma 1, CARMA1, Caspase recruitment domain-containing protein 11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68269 targets CARD11 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16468

Product name: Recombinant human CARD11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 798-1147 aa of BC111719

Sequence: DTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL

Predict reactive species
Full Name caspase recruitment domain family, member 11
Calculated Molecular Weight 1154 aa, 133 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC111719
Gene Symbol CARD11
Gene ID (NCBI) 84433
RRIDAB_3672984
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BXL7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CARD11 also named as ,BIMP3 or CARMA1, is a 1154 amino acid protein, which contains one PDZ domain, one guanylate kinase-like domain, and one CARD domain. CARD11 localizes in the cytoplasm and co-localized with DPP4 in membrane raft. CARD11 is detected in adult peripheral blood leukocytes, thymus, spleen and liver. CARD11 also is found in CARD11 promyelocytic leukemia HL-60 cells, chronic myelogenous leukemia K-562 cells, Burkitt's lymphoma Raji cells and colorectal adenocarcinoma SW480 cells. CARD11 is involved in the co-stimulatory signal essential for T-cell receptor mediated T-cell activation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CARD11 antibody CL488-68269Download protocol
IF protocol for CL Plus 488 CARD11 antibody CL488-68269Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...