CoraLite® Plus 488-conjugated CBX5 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-83258-6

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 CBX5 antibody (CL488-83258-6, Clone: 240145G12 ) at dilution of 1:200.

CBX5 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83258-6

Clone No.240145G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

240145G12, Antigen p25, HP1, HP1 alpha, HP1A

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83258-6 targets CBX5 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34810

  Product name: Recombinant human CBX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-120 aa of BC006821

  Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG

• Full Name: chromobox homolog 5 (HP1 alpha homolog, Drosophila)
• Calculated Molecular Weight: 191 aa, 22 kDa
• GenBank Accession Number: BC006821
• Gene Symbol: CBX5
• Gene ID (NCBI): 23468
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P45973
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.