Use Able AI chat for product recommendations
  • KD/KO Validated

CoraLite® Plus 488-conjugated CBX5 Recombinant monoclonal antibody

CBX5 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-83258-6
Clone No.240145G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240145G12, Antigen p25, HP1, HP1 alpha, HP1A

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83258-6 targets CBX5 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34810

Product name: Recombinant human CBX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-120 aa of BC006821

Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG

Predict reactive species
Full Name chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Calculated Molecular Weight 191 aa, 22 kDa
GenBank Accession NumberBC006821
Gene Symbol CBX5
Gene ID (NCBI) 23468
RRIDAB_3747365
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP45973
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CBX5 antibody CL488-83258-6Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...