Tested Applications
| Positive FC (Intra) detected in | LPS and Brefeldin A treated J774A.1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98194-1-RR targets CCL3/MIP-1 alpha in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2170 Product name: Recombinant Mouse CCL3 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011337 Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 3 |
| Calculated Molecular Weight | 10kd |
| GenBank Accession Number | NM_011337 |
| Gene Symbol | Ccl3 |
| Gene ID (NCBI) | 20302 |
| RRID | AB_3672331 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10855 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CCL3/MIP-1 alpha antibody 98194-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-Mouse CCL3/MIP-1α Rabbit Recombinant Antibody (Cat# 98194-1-RR) has 1 citation to date. It was cited in Immun Ageing (2026) in a study investigating how aging-induced loss of progenitor B cells promotes osteoclastogenesis in bone marrow macrophages through ROS-activated Fos/CCL3 signaling. The research falls within the fields of immunology, aging biology, and bone metabolism, with the antibody applied in flow cytometry for mouse samples.
| Species | Application | Title |
|---|---|---|
Immun Ageing Aging-induced decrease in progenitor B cells enhances the osteoclastogenesis of bone marrow macrophages via ROS-activated Fos/CCL3 signaling pathway. |
