CoraLite®594 Anti-Mouse CCL3/MIP-1 alpha Rabbit Recombinant Antibody

CCL3/MIP-1 alpha Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL594-98194
Clone No.241695B10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

241695B10, C-C motif chemokine 3, Ccl3, Heparin-binding chemotaxis protein, L2G25B

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inLPS and Brefeldin A treated J774A.1 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98194 targets CCL3/MIP-1 alpha in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2170

Product name: Recombinant Mouse CCL3 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 24-92 aa of NM_011337

Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Predict reactive species
Full Name chemokine (C-C motif) ligand 3
Calculated Molecular Weight10kd
GenBank Accession NumberNM_011337
Gene Symbol Ccl3
Gene ID (NCBI) 20302
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10855
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells.

Protocols

Product Specific Protocols
FC protocol for CL594 CCL3/MIP-1 alpha antibody CL594-98194Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...