CoraLite® Plus 555 Anti-Mouse CD107a / LAMP1 Rabbit Recombinant Antibody

CD107a / LAMP1 Uni-rAb® Recombinant Antibody for FC
Cat No. CL555-98537-2
Clone No.250972H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD107a, Lamp1, Lamp 1

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse peritoneal macrophages

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-98537-2 targets CD107a / LAMP1 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3858

Product name: Recombinant Mouse LAMP-1/CD107a protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 25-370 aa of NM_010684.3

Sequence: LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN

Predict reactive species
Full Name lysosomal-associated membrane protein 1
Calculated Molecular Weight44 kDa
GenBank Accession NumberNM_010684.3
Gene Symbol CD107a
Gene ID (NCBI) 16783
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
Excitation LaserGreen Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11438
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

LAMP1 (CD107a) is a heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP1 is expressed largely in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane (PMID: 16168398). Elevated LAMP1 expression at the cell surface has also been detected during platelet and granulocytic cell activation, as well as in some tumor cells (PMID: 29085473). LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis (PMID: 18835598; 29085473; 9426697).

Protocols

Product Specific Protocols
FC protocol for CL Plus 555 CD107a / LAMP1 antibody CL555-98537-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...