PE Anti-Mouse CD117/c-Kit Rabbit Recombinant Antibody

CD117/c-Kit Uni-rAb® Recombinant Antibody for FC
Cat No. PE-98041
Clone No.240246C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD117, Kit, 240246C11, c KIT

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse bone marrow cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.1 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-98041 targets CD117/c-Kit in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0883

Product name: Recombinant Mouse CD117/c-kit protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 25-527 aa of NM_001122733.1

Sequence: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP

Predict reactive species
Full Name kit oncogene
Calculated Molecular Weight109 kDa
GenBank Accession NumberNM_001122733.1
Gene Symbol CD117
Gene ID (NCBI) 16590
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05532-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD117, also known as c-Kit and SCFR, is a transmembrane protein with tyrosine kinase activity encoded by the oncogene c-kit (PMID: 2448137). It is a member of the type III receptor tyrosine kinase family, which also includes CSF-1R, PDGFRβ, PDGFRα, and FLT3 (PMID: 29518044). CD117 is expressed on hematopoietic stem cells and progenitor cells, mast cells, and is also found in a wide range of non-haemopoietic cell types (including melanocytes, germ cells, astrocytes, renal tubules, breast glandular epithelial cells, sweat glands, and interstitial cells of Cajal) (PMID: 10582338; 23073628). CD117 plays an important role in early haemopoiesis. It is also involved in pigmentation, fertility, gut movement, and some aspects of the nervous system (PMID: 23073628).

Protocols

Product Specific Protocols
FC protocol for PE CD117/c-Kit antibody PE-98041Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...