FITC Plus Anti-Human CD134/OX40 Rabbit Recombinant Antibody

CD134/OX40 Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98181
Clone No.241398G7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

TNFRSF4, 241398G7, ACT35, ACT35 antigen, CD134

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPHA-treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98181 targets CD134/OX40 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1261

Product name: Recombinant Human CD134/OX40 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 29-214 aa of NM_003327

Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 4
Calculated Molecular Weight 29 kDa
GenBank Accession NumberNM_003327
Gene Symbol CD134
Gene ID (NCBI) 7293
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP43489
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222).

Protocols

Product Specific Protocols
FC protocol for FITC Plus CD134/OX40 antibody FITC-98181Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...