• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ APC Anti-Human CD14 Rabbit Recombinant Antibody

CD14 FcZero-rAbTM Recombinant Antibody for FC
Cat No. APC-FcA98040
Clone No.230332D7

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

230332D7, CD14 molecule, Monocyte differentiation antigen CD14, membrane-bound form, Monocyte differentiation antigen CD14, urinary form, Myeloid cell-specific leucine-rich glycoprotein

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98040 targets CD14 in FC applications and shows reactivity with human, monkey, non-human primates samples.

Tested Reactivity human, monkey, non-human primates
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0498

Product name: Recombinant human CD14 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 20-344 aa of BC010507

Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM

Predict reactive species
Full Name CD14 molecule
Calculated Molecular Weight 375 aa, 40 kDa
GenBank Accession NumberBC010507
Gene Symbol CD14
Gene ID (NCBI) 929
ENSEMBL Gene IDENSG00000170458
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08571
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.

Protocols

Product Specific Protocols
FC protocol for APC CD14 antibody APC-FcA98040Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...