• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PE-Cyanine5.5 Anti-Human CD14 Rabbit Recombinant Antibody

CD14 FcZero-rAb® Recombinant Antibody for FC

Cat No. PY5P5-FcA98040
Clone No.230332D7

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

CD14 molecule, Monocyte differentiation antigen CD14, membrane-bound form, Monocyte differentiation antigen CD14, urinary form, Myeloid cell-specific leucine-rich glycoprotein

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PY5P5-FcA98040 targets CD14 in FC applications and shows reactivity with human, monkey, non-human primates samples.

Tested Reactivity human, monkey, non-human primates
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0498

Product name: Recombinant human CD14 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 20-344 aa of BC010507

Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM

Predict reactive species
Full Name CD14 molecule
Calculated Molecular Weight 375 aa, 40 kDa
GenBank Accession NumberBC010507
Gene Symbol CD14
Gene ID (NCBI) 929
ENSEMBL Gene IDENSG00000170458
Conjugate PE-Cyanine5.5 Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 692 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08571
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.

Protocols

Product Specific Protocols
FC protocol for PE-Cyanine5.5 CD14 antibody PY5P5-FcA98040Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...