CoraLite® Plus 405 Anti-Mouse CD14 Rabbit Recombinant Antibody

• 

  FC experiment of mouse peritoneal macrophages using CL405-98020

  1x10^6 mouse peritoneal macrophages were surface stained with 0.25 ug CoraLite® Plus 405 Anti-Mouse CD14 Rabbit RecAb (CL405-98020, Clone: 240225C2) (red) or 0.25 ug CoraLite® Plus 405 Rabbit IgG Isotype Control Recombinant Antibody (CL405-98136, Clone: 240953C9) (blue). Cells were not fixed.

CD14 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL405-98020

Clone No.240225C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

240225C2, CD14 antigen

---

Tested Applications

• Positive FC detected in: mouse peritoneal macrophages

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL405-98020 targets CD14 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0847

  Product name: Recombinant mouse CD14 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 16-345 aa of NM_009841.4

  Sequence: SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP

• Full Name: CD14 antigen
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: NM_009841.4
• Gene Symbol: Cd14
• Gene ID (NCBI): 12475
• Conjugate: CoraLite® Plus 405 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 399 nm / 422 nm
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10810
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.