CoraLite® Plus 488 Anti-Mouse CD14 Rabbit Recombinant Antibody

• 

  FC experiment of mouse peritoneal macrophages using CL488-98020

  1x10^6 mouse peritoneal macrophages were stained with 0.25 ug CoraLite® Plus 488 Anti-Mouse CD14 Rabbit Recombinant Antibody (CL488-98020, Clone:240225C2)(red), or Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CD14 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL488-98020

Clone No.240225C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

240225C2, CD14 antigen

---

Tested Applications

• Positive FC detected in: mouse peritoneal macrophages

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98020 targets CD14 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0847

  Product name: Recombinant mouse CD14 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 16-345 aa of NM_009841.4

  Sequence: SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP

• Full Name: CD14 antigen
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: NM_009841.4
• Gene Symbol: Cd14
• Gene ID (NCBI): 12475
• RRID: AB_3673365
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10810
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.