CoraLite® Plus 488-conjugated CD14 Polyclonal antibody

• 

  IF Staining of human tonsillitis using CL488-17000

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 CD14 antibody (CL488-17000) at dilution of 1:400.

• 

  IF Staining of human tonsillitis using CL488-17000

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488 CD14 antibody (CL488-17000) at dilution of 1:400.

CD14 Polyclonal Antibody for IF-P

Cat No. CL488-17000

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

Synonyms

CD14, CD14 molecule

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17000 targets CD14 in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10693

  Product name: Recombinant human CD14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-375 aa of BC010507

  Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

• Full Name: CD14 molecule
• Calculated Molecular Weight: 375 aa, 40 kDa
• GenBank Accession Number: BC010507
• Gene Symbol: CD14
• Gene ID (NCBI): 929
• ENSEMBL Gene ID: ENSG00000170458
• RRID: AB_2919143
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08571
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS.