CoraLite®700 Anti-Human CD226 Rabbit Recombinant Antibody

CD226 Uni-rAb® Recombinant Antibody for FC
Cat No. CL700-98002-2
Clone No.240673G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

240673G4, CD226 antigen, CD226 molecule, DNAM 1, DNAM1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL700-98002-2 targets CD226 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0027

Product name: Recombinant Human CD226 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 19-247 aa of BC074787

Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Predict reactive species
Full Name CD226 molecule
Calculated Molecular Weight 336 aa, 39 kDa
GenBank Accession NumberBC074787
Gene Symbol CD226
Gene ID (NCBI) 10666
ENSEMBL Gene IDENSG00000150637
Conjugate CoraLite®700 Fluorescent Dye
Excitation/Emission Maxima Wavelengths702 nm / 723 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15762
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD226 (DNAM-1) is a ~65 kDa glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. CD226 mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Interactions of CD226 and its ligands, CD155 and CD112, induce NK and T cell-mediated cytotoxicity and cytokine secretion (PMID: 15039383).

Protocols

Product Specific Protocols
FC protocol for CL700 CD226 antibody CL700-98002-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...