FITC Plus Anti-Human CD226 Rabbit Recombinant Antibody

CD226 Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98002
Clone No.240673G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

240673G4, CD226 antigen, CD226 molecule, DNAM 1, DNAM1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98002 targets CD226 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0027

Product name: Recombinant Human CD226 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 19-247 aa of BC074787

Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Predict reactive species
Full Name CD226 molecule
Calculated Molecular Weight 336 aa, 39 kDa
GenBank Accession NumberBC074787
Gene Symbol CD226
Gene ID (NCBI) 10666
ENSEMBL Gene IDENSG00000150637
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15762
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD226 (DNAM-1) is a ~65 kDa glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. CD226 mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Interactions of CD226 and its ligands, CD155 and CD112, induce NK and T cell-mediated cytotoxicity and cytokine secretion (PMID: 15039383).

Protocols

Product Specific Protocols
FC protocol for FITC Plus CD226 antibody FITC-98002Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...