Mouse CD23 Recombinant monoclonal antibody, PBS Only (Detector)

CD23 Uni-rAb® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84212-3-PBS
Clone No.241385C9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

241385C9, Fc-epsilon-RII, Fcer2, Fcer2a, Low affinity immunoglobulin epsilon Fc receptor

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84212-3-PBS targets CD23 as part of a matched antibody pair:

MP01134-2: 84212-4-PBS capture and 84212-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1295

Product name: Recombinant Mouse CD23 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 51-331 aa of EDL21948.1

Sequence: TEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP

Predict reactive species
Full Name Fc receptor, IgE, low affinity II, alpha polypeptide
Calculated Molecular Weight38kDa
Observed Molecular Weight46 kDa
GenBank Accession NumberEDL21948.1
Gene Symbol Fcer2a
Gene ID (NCBI) 14128
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP20693-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD23/Fc ε RII) is a low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21, involved in B cell differentiation and IgE regulation. Two forms of Fc ε RII (Fc ε RIIa and Fc ε RIIb) were found to exist, which differ in structure only in the N-terminal cytoplasmic region, and Fc ε RIIa and Fc ε RIIb play roles in effector cells of B-cell and IgE-mediated immunity, respectively. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells. On macrophages, after IgE binding and antigen cross-linking, intracellular killing of parasites is induced by activation of the L-arginine-nitric oxide pathway.

Loading...
||
New chat Able
正在加载,请稍候...