Rat CD25/IL-2RA Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86213-1-RR (same clone as 86213-1-PBS)

  Recombinant protein were subjected to SDS PAGE followed by western blot with 86213-1-RR (CD25/IL-2R alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86213-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86213-1-RR (same clone as 86213-1-PBS)

  CTLL-2 cells were subjected to SDS PAGE followed by western blot with 86213-1-RR (CD25/IL-2R alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86213-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02447-1

  Serum of sixteen rats was measured. The CD25/IL-2RA concentration of detected samples was determined to be 0.89 ng/mL with a range of 0.44-5.27 ng/mL.

• 

  Sandwich ELISA standard curve of MP02447-1

  Sandwich ELISA standard curve of MP02447-1, Rat CD25/IL-2RA Recombinant Matched Antibody Pair - PBS only. 86213-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1453. 86213-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

CD25/IL-2RA Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86213-1-PBS

Clone No.250670H3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

CD25, IL-2 receptor subunit alpha, IL-2R subunit alpha, Il2ra, IL-2-RA

---

Product Information

86213-1-PBS targets CD25/IL-2RA as part of a matched antibody pair:

MP02447-1: 86213-1-PBS capture and 86213-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1453

  Product name: Recombinant Rat CD25/IL-2R alpha protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-235 aa of NM_013163.1

  Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ

• Full Name: interleukin 2 receptor, alpha
• Calculated Molecular Weight: 31kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: NM_013163.1
• Gene Symbol: Il2ra
• Gene ID (NCBI): 25704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26897
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+ Foxp3+ Treg cells (PMID: 22585674).