FcZero-rAb® CoraLite® Plus 647 Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody

• 

  FC experiment of mouse splenocytes using CL647-FcA98288

  1x10^6 untreated or anti-CD3/CD28 treated mouse splenocytes were surface stained with PE Anti-Mouse CD4 (RM4-4) and 0.25 ug CoraLite® Plus 647 Anti-Mouse CD25/IL-2RA Rabbit RecAb (CL647-FcA98288, Clone: 242494H5). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD25/IL-2RA FcZero-rAb^® Recombinant Antibody for FC

Cat No. CL647-FcA98288

Clone No.242494H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD25, IL-2 receptor subunit alpha, Il2r, IL-2R subunit alpha, Il2ra

---

Tested Applications

• Positive FC detected in: Anti-CD3/CD28 treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-FcA98288 targets CD25/IL-2RA in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3087

  Product name: Recombinant Mouse CD25/IL2RA protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-236 aa of NM_008367.3

  Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

• Full Name: interleukin 2 receptor, alpha chain
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008367.3
• Gene Symbol: CD25
• Gene ID (NCBI): 16184
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01590
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+Foxp3+ Treg cells and a subset of human CD4+ memory T cells (PMID: 22585674).