Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PerCP-Cyanine5.5 Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody

CD25/IL-2RA FcZero-rAb® Recombinant Antibody for FC

Cat No. CPY5-FcA98288
Clone No.242494H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD25, IL-2 receptor subunit alpha, Il2r, IL-2R subunit alpha, Il2ra

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inanti-CD3/CD28 treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CPY5-FcA98288 targets CD25/IL-2RA in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3087

Product name: Recombinant Mouse CD25/IL2RA protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 22-236 aa of NM_008367.3

Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Predict reactive species
Full Name interleukin 2 receptor, alpha chain
Calculated Molecular Weight31 kDa
GenBank Accession NumberNM_008367.3
Gene Symbol CD25
Gene ID (NCBI) 16184
Conjugate PerCP-Cyanine5.5 Fluorescent Dye
Excitation/Emission Maxima Wavelengths482 nm / 690nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01590
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+Foxp3+ Treg cells and a subset of human CD4+ memory T cells (PMID: 22585674).

Protocols

Product Specific Protocols
FC protocol for PerCP-Cyanine5.5 CD25/IL-2RA antibody CPY5-FcA98288Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...