Product Information
32930-1-PBS targets CD2BP2 in applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38662 Product name: Recombinant human CD2BP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-341 aa of NM_001243646.1 Sequence: MFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT* Predict reactive species |
| Full Name | CD2 (cytoplasmic tail) binding protein 2 |
| Calculated Molecular Weight | 38kDa,341aa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | NM_001243646.1 |
| Gene Symbol | CD2BP2 |
| Gene ID (NCBI) | 10421 |
| RRID | AB_3742794 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O95400 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD2BP2 (CD2-binding protein 2) is a multifunctional protein that was initially identified as a binding partner of the T-cell surface antigen CD2. It binds to the cytoplasmic tail of CD2 through its C-terminal GYF domain in the cytoplasm, regulating CD2-mediated T-lymphocyte activation. Additionally, CD2BP2 is a component of the U5 small nuclear ribonucleoprotein complex (snRNP), participating in the RNA splicing process. Studies have shown that CD2BP2 plays a crucial role in embryonic development; its absence leads to delayed embryonic growth, vascularization defects, and death by embryonic day 10.5. Specific depletion of CD2BP2 in renal podocytes results in proteinuria and ultimately fatal renal failure.

