CD3 Delta Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CD3 Delta Polyclonal antibody, PBS Only (16669-1-PBS)

• 

  WB analysis using 16669-1-AP (same clone as 16669-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16669-1-AP (CD3 Delta antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16669-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16669-1-AP (same clone as 16669-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16669-1-AP (CD3 delta antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16669-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 16669-1-AP (same clone as 16669-1-PBS)

  IP result of anti-CD3 Delta (IP:16669-1-AP, 4ug; Detection:16669-1-AP 1:800) with Jurkat cells lysate 2800ug. This data was developed using the same antibody clone with 16669-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 16669-1-AP (same clone as 16669-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD3 Delta antibody (16669-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16669-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 16669-1-AP (same clone as 16669-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD3 Delta antibody (16669-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16669-1-PBS in a different storage buffer formulation.

CD3 Delta Polyclonal Antibody for WB, IF-P, IP, Indirect ELISA

Cat No. 16669-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IP, Indirect ELISA

Synonyms

CD3D, T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, T3D, T cell receptor T3 delta chain

---

Product Information

16669-1-PBS targets CD3 Delta in WB, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10148

  Product name: Recombinant human CD3D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-171 aa of BC070321

  Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

• Full Name: CD3d molecule, delta (CD3-TCR complex)
• Calculated Molecular Weight: 171 aa, 19 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC070321
• Gene Symbol: CD3 Delta
• Gene ID (NCBI): 915
• RRID: AB_10598004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04234
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.