Use Able AI chat for product recommendations

CD3 Delta Polyclonal antibody, PBS Only

CD3 Delta Polyclonal Antibody for WB, IF-P, IP, Indirect ELISA

Cat No. 16669-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IP, Indirect ELISA

CD3D, T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, T3D, T cell receptor T3 delta chain

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16669-1-PBS targets CD3 Delta in WB, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10148

Product name: Recombinant human CD3D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-171 aa of BC070321

Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

Predict reactive species
Full Name CD3d molecule, delta (CD3-TCR complex)
Calculated Molecular Weight 171 aa, 19 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC070321
Gene Symbol CD3 Delta
Gene ID (NCBI) 915
RRIDAB_10598004
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04234
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.

Loading...
||
New chat

Able

正在加载,请稍候...