Use Able AI chat for product recommendations

Mouse CD3 Delta Recombinant monoclonal antibody, PBS Only (Capture)

CD3 Delta Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87532-1-PBS
Clone No.252849B8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

CD3d, T3d, T-cell receptor T3 delta chain, T-cell surface glycoprotein CD3 delta chain

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87532-1-PBS targets CD3 Delta as part of a matched antibody pair:

MP03077-2: 87532-1-PBS capture and 87532-7-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4665

Product name: recombinant mouse CD3D protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 22-105 aa of NM_013487.3

Sequence: FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA

Predict reactive species
Full Name CD3 antigen, delta polypeptide
Calculated Molecular Weight19 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberNM_013487.3
Gene Symbol Cd3d
Gene ID (NCBI) 12500
RRIDAB_3745603
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04235
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.

Loading...
||
New chat

Able

正在加载,请稍候...