Use Able AI chat for product recommendations

CD3 Delta Recombinant monoclonal antibody

CD3 Delta Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 87532-1-RR
Clone No.252849B8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

CD3d, T3d, T-cell receptor T3 delta chain, T-cell surface glycoprotein CD3 delta chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse thymus tissue, rat thymus tissue, mouse spleen tissue, rat spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87532-1-RR targets CD3 Delta in WB, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4665

Product name: recombinant mouse CD3D protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 22-105 aa of NM_013487.3

Sequence: FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA

Predict reactive species
Full Name CD3 antigen, delta polypeptide
Calculated Molecular Weight19 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberNM_013487.3
Gene Symbol Cd3d
Gene ID (NCBI) 12500
RRIDAB_3745603
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04235
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.

Protocols

Product Specific Protocols
WB protocol for CD3 Delta antibody 87532-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...