CD300LG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CD300LG Polyclonal antibody, PBS Only (15426-1-PBS)

• 

  WB analysis of human kidney using 15426-1-AP (same clone as 15426-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15426-1-AP (CD300LG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15426-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15426-1-AP (same clone as 15426-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15426-1-AP (CD300LG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15426-1-PBS in a different storage buffer formulation.

CD300LG Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15426-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD300 antigen-like family member G, CD300g, CLM 9, CLM9, CLM-9

---

Product Information

15426-1-PBS targets CD300LG in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8075

  Product name: Recombinant human CD300LG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-332 aa of BC025395

  Sequence: EISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLNSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA

• Full Name: CD300 molecule-like family member g
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC025395
• Gene Symbol: CD300LG
• Gene ID (NCBI): 146894
• RRID: AB_2074217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXG3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD300LG, also known as CLM9 (CMRF35-like molecule 9), is a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. CD300LG is a receptor which may mediate L-selectin-dependent lymphocyte rollings and may play an important role in inflammation.