Anti-Human CD32 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human CD32 Rabbit Recombinant Antibody (98601-2-RR)

• 

  FC experiment of human peripheral blood lymphocytes using 98601-2-RR

  1x10^6 human peripheral blood lymphocytes were surface stained with 0.25 ug Anti-Human CD32 Rabbit RecAb (98601-2-RR, Clone: 251087D9) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human HLA-DR. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood lymphocytes using 98601-2-RR

  1x10^6 human peripheral blood lymphocytes were surface stained with 0.25 ug Anti-Human CD32 Rabbit RecAb (98601-2-RR, Clone: 251087D9) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98601-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98601-2-RR against Human CD32 were performed. The affinity constant is 4.86 nM.

CD32 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98601-2-RR

Clone No.251087D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD32A, Fc gamma RII a, Fc gamma RIIa, FCG2, Fc-gamma RII-a

---

Tested Applications

• Positive FC detected in: human peripheral blood lymphocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98601-2-RR targets CD32 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2713

  Product name: Recombinant Human FCGR2A/CD32a protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 34-217 aa of NM_001136219.3

  Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG

• Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_001136219.3
• Gene Symbol: CD32a
• Gene ID (NCBI): 2212
• RRID: AB_3746209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12318-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.