CoraLite® Plus 488-conjugated CD32 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated CD32 Recombinant monoclonal antibody (CL488-86588-2)

CD32 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86588-2

Clone No.251087D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CD32A, Fc gamma RII a, Fc gamma RIIa, FCG2, Fc-gamma RII-a

• 

  IF Staining of K-562 using CL488-86588-2

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using CoraLite® Plus 488 CD32 antibody (CL488-86588-2, Clone: 251087D9 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U-937 using CL488-86588-2

  Immunofluorescent analysis of (4% PFA) fixed U-937 cells using CoraLite® Plus 488 CD32 antibody (CL488-86588-2, Clone: 251087D9 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: K-562 cells, U-937 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86588-2 targets CD32 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2713

  Product name: Recombinant Human FCGR2A/CD32a protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 34-217 aa of NM_001136219.3

  Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG

• Full Name: Fc fragment of IgG, low affinity IIa, receptor (CD32)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_001136219.3
• Gene Symbol: CD32a
• Gene ID (NCBI): 2212
• RRID: AB_3747851
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12318-1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes.