FcZero-rAb™ Biotin Anti-Human CD36 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using Biotin-FcA98132

  1x10^6 human PBMCs were surface stained with 0.25 ug Biotin Anti-Human CD36 Rabbit RecAb (Biotin-FcA98132, Clone: 241262D5) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were co-stained with FcZero-rAb™ APC Anti-Human HLA-DR (L243) Rabbit IgG Recombinant Antibody (APC-FcA65560, Clone: L243). Cells were not fixed.

• 

  FC experiment of human PBMCs using Biotin-FcA98132

  1x10^6 human PBMCs were surface stained with 0.25 ug Biotin Anti-Human CD36 Rabbit RecAb (Biotin-FcA98132, Clone: 241262D5) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD36 FcZero-rAb^TM Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98132

Clone No.241262D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

241262D5, Glycoprotein IIIb, GP3B, GP4, GPIIIB

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98132 targets CD36 in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1070

  Product name: Recombinant Human CD36/SR-B3 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 30-439 aa of NM_001001548.3

  Sequence: GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

• Full Name: CD36 molecule (thrombospondin receptor)
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: NM_001001548.3
• Gene Symbol: CD36
• Gene ID (NCBI): 948
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16671-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD36, also named GP3B and GP4, is an 88-kDa membrane glycoprotein present on platelets, monocytes, erythroid precursors, endothelial cells, and several tumor cell lines. CD36 binds to collagen, thrombospondin, anionic phospholipids, and long-chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport and oxidized LDL. CD36 may function as a cell adhesion molecule. It mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Mutation of CD36 will cause platelet glycoprotein IV deficiency which is known as CD36 deficiency. Genetic variations in CD36 are associated with susceptibility to coronary heart disease type 7 (CHDS7).