FcZero-rAb® CoraLite® Plus 647 Anti-Human CD36 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® CoraLite® Plus 647 Anti-Human CD36 Rabbit Recombinant Antibody (CL647-FcA98132)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD36 FcZero-rAb^® Recombinant Antibody for FC

Cat No. CL647-FcA98132

Clone No.241262D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

Glycoprotein IIIb, GP3B, GP4, GPIIIB, GPIV

• 

  FC experiment of human PBMCs using CL647-FcA98132

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 405 Anti-Human HLA-DR (L243), and 5 ul CoraLite® Plus 647 Anti-Human CD36 Rabbit RecAb (CL647-FcA98132, Clone: 241262D5) or FcZero-rAb® CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-FcA98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL647-FcA98132

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 647 Anti-Human CD36 Rabbit RecAb (CL647-FcA98132, Clone: 241262D5) (red) or FcZero-rAb® CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-FcA98132 targets CD36 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1070

  Product name: Recombinant Human CD36/SR-B3 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 30-439 aa of NM_001001548.3

  Sequence: GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

• Full Name: CD36 molecule (thrombospondin receptor)
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: NM_001001548.3
• Gene Symbol: CD36
• Gene ID (NCBI): 948
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16671-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD36, also named GP3B and GP4, is an 88-kDa membrane glycoprotein present on platelets, monocytes, erythroid precursors, endothelial cells, and several tumor cell lines. CD36 binds to collagen, thrombospondin, anionic phospholipids, and long-chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport and oxidized LDL. CD36 may function as a cell adhesion molecule. It mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Mutation of CD36 will cause platelet glycoprotein IV deficiency which is known as CD36 deficiency. Genetic variations in CD36 are associated with susceptibility to coronary heart disease type 7 (CHDS7).