CD47 Monoclonal antibody, PBS Only

• 

  WB analysis of A549 using 66304-1-Ig (same clone as 66304-1-PBS)

  WB result of CD47 antibody (66304-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD47 transfected A549 cells. This data was developed using the same antibody clone with 66304-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66304-1-Ig (same clone as 66304-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66304-1-Ig (CD47 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66304-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66304-1-Ig (same clone as 66304-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66304-1-Ig (CD47 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66304-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66304-1-Ig (same clone as 66304-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66304-1-Ig (CD47 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66304-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 66304-1-Ig (same clone as 66304-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CD47 antibody (66304-1-Ig, Clone: 1E1D8 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 66304-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CD47 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66304-1-PBS

Clone No.1E1D8

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Leukocyte surface antigen CD47, Integrin-associated protein, Integrin associated protein, IAP, CD47 molecule

---

Product Information

66304-1-PBS targets CD47 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14132

  Product name: Recombinant human CD47 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC010016

  Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI

• Full Name: CD47 molecule
• Calculated Molecular Weight: 323 aa, 35 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC010016
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• RRID: AB_2881687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08722
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.