• Featured Product
  • KD/KO Validated

CoraLite®532-conjugated CD47 Monoclonal antibody

CD47 Monoclonal Antibody for IF/ICC
Cat No. CL532-66304
Clone No.1E1D8

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC

Leukocyte surface antigen CD47, Integrin-associated protein, Integrin associated protein, IAP, CD47 molecule

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®532
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells, Jurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL532-66304 targets CD47 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14132

Product name: Recombinant human CD47 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-150 aa of BC010016

Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI

Predict reactive species
Full Name CD47 molecule
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC010016
Gene Symbol CD47
Gene ID (NCBI) 961
Conjugate CoraLite®532 Fluorescent Dye
Excitation/Emission Maxima Wavelengths537 nm / 560 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08722
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.

Protocols

Product Specific Protocols
IF protocol for CL532 CD47 antibody CL532-66304Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...